Lineage for d1gh0w_ (1gh0 W:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 44707Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
  6. 44725Protein Phycocyanin [46533] (5 species)
  7. 44741Species Spirulina platensis [TaxId:118562] [63444] (1 PDB entry)
  8. 44764Domain d1gh0w_: 1gh0 W: [60513]

Details for d1gh0w_

PDB Entry: 1gh0 (more details), 2.2 Å

PDB Description: crystal structure of c-phycocyanin from spirulina platensis

SCOP Domain Sequences for d1gh0w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gh0w_ a.1.1.3 (W:) Phycocyanin {Spirulina platensis}
mktplteavsvadsqgrflssteiqvafgrfrqakagleaakaltskadslisgaaqavy
nkfpyttqmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagideinr
tfelspswyiealkyikanhglsgdaaveansyldyainals

SCOP Domain Coordinates for d1gh0w_:

Click to download the PDB-style file with coordinates for d1gh0w_.
(The format of our PDB-style files is described here.)

Timeline for d1gh0w_: