Lineage for d1gf4a_ (1gf4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924284Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2925293Species Human (Homo sapiens) [TaxId:9606] [53969] (204 PDB entries)
    Uniprot P00695
  8. 2925464Domain d1gf4a_: 1gf4 A: [60476]
    complexed with na; mutant

Details for d1gf4a_

PDB Entry: 1gf4 (more details), 1.8 Å

PDB Description: buried polar mutant human lysozyme
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1gf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gf4a_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadatacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d1gf4a_:

Click to download the PDB-style file with coordinates for d1gf4a_.
(The format of our PDB-style files is described here.)

Timeline for d1gf4a_: