Lineage for d1g7fa_ (1g7f A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) 
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) Protein Tyrosine phosphatase [52806] (7 species) Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (28 PDB entries) 
Domain d1g7fa_: 1g7f A: [60330]
Details for d1g7fa_
PDB Entry: 1g7f (more details), 1.8 Å
PDB Description: human ptp1b catalytic domain complexed with pnu177496
SCOP Domain Sequences for d1g7fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7fa_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
SCOP Domain Coordinates for d1g7fa_:
Click to download the PDB-style file with coordinates for d1g7fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g7fa_:
- d1g7fa_ first appeared in SCOP 1.57
- d1g7fa_ appears in SCOP 1.61
- d1g7fa_ appears in the current release, SCOPe 2.08
View in 3D