Lineage for d1g59a1 (1g59 A:306-468)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216220Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 216221Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (2 families) (S)
  5. 216222Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein)
  6. 216223Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species)
  7. 216224Species Thermus thermophilus [TaxId:274] [48166] (6 PDB entries)
  8. 216232Domain d1g59a1: 1g59 A:306-468 [60257]
    Other proteins in same PDB: d1g59a2, d1g59c2

Details for d1g59a1

PDB Entry: 1g59 (more details), 2.4 Å

PDB Description: glutamyl-trna synthetase complexed with trna(glu).

SCOP Domain Sequences for d1g59a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g59a1 a.97.1.1 (A:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala

SCOP Domain Coordinates for d1g59a1:

Click to download the PDB-style file with coordinates for d1g59a1.
(The format of our PDB-style files is described here.)

Timeline for d1g59a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g59a2