Lineage for d1g0oc_ (1g0o C:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins) 
Protein 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) [51798] (1 species) Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51799] (4 PDB entries) 
Domain d1g0oc_: 1g0o C: [60183]
Details for d1g0oc_
PDB Entry: 1g0o (more details), 1.7 Å
PDB Description: structure of trihydroxynaphthalene reductase in complex with nadph and pyroquilon
SCOP Domain Sequences for d1g0oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g0oc_ c.2.1.2 (C:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea)}
avtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyan
stesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfgh
vkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgsk
gaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavq
wsplrrvglpidiarvvcflasndggwvtgkvigidggacm
SCOP Domain Coordinates for d1g0oc_:
Click to download the PDB-style file with coordinates for d1g0oc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g0oc_:
- d1g0oc_ is new in SCOP 1.57
- d1g0oc_ appears in SCOP 1.59
- d1g0oc_ appears in the current release, SCOPe 2.08
View in 3D
