SCOPe 2.04: Domain d1g0ca_: 1g0c A:

Lineage for d1g0ca_ (1g0c A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Alkaline cellulase K catalytic domain [63906] (1 species)

7. Species Bacillus sp. [TaxId:1409] [63907] (2 PDB entries)

8. Domain d1g0ca_: 1g0c A: [60165]
   complexed with cellobiose
   complexed with acy, cbi, cd

Details for d1g0ca_

PDB Entry: 1g0c, 1.9 Å

PDB Description: alkaline cellulase k catalytic domain-cellobiose complex

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d1g0ca_:

Sequence; same for both SEQRES and ATOM records:

>d1g0ca_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]}
pagmqavkspseagalqlvelngqltlagedgtpvqlrgmsthglqwfgeivnenafval
sndwgsnmirlamyigengyatnpevkdlvyegielafehdmyvivdwhvhapgdpradv
ysgaydffeeiadhykdhpknhyiiwelanepspnnnggpgltndekgweavkeyaepiv
emlrekgdnmilvgnpnwsqrpdlsadnpidaenimysvhfytgshgashigypegtpss
ersnvmanvryaldngvavfatewgtsqangdggpyfdeadvwlnflnkhniswanwslt
nkneisgaftpfelgrtdatdldpganqvwapeelslsgeyvrarikgieytpidrtk

Timeline for d1g0ca_:

• d1g0ca_ first appeared in SCOP 1.57
  
• d1g0ca_ appears in SCOPe 2.03
  
• d1g0ca_ appears in SCOPe 2.05
  
• d1g0ca_ appears in the current release, SCOPe 2.08, called d1g0ca1