Lineage for d1fz9a_ (1fz9 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279915Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 279957Protein Methane monooxygenase hydrolase alpha subunit [88789] (2 species)
  7. 279958Species Methylococcus capsulatus [TaxId:414] [88790] (15 PDB entries)
  8. 279979Domain d1fz9a_: 1fz9 A: [60128]
    Other proteins in same PDB: d1fz9c_, d1fz9d_, d1fz9e_, d1fz9f_

Details for d1fz9a_

PDB Entry: 1fz9 (more details), 2.3 Å

PDB Description: Methane monooxygenase hydroxylase, form II cocrystallized with iodoethane
PDB Compounds: (A:)

SCOP Domain Sequences for d1fz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz9a_ a.25.1.2 (A:) Methane monooxygenase hydrolase alpha subunit {Methylococcus capsulatus}
nraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavkde
rqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqkng
ylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfisgd
avecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtvvs
iandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwggi
wigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfeany
pgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgastl
rvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktli
aqphvrgdklwtlddikrlncvfknpvkafn

SCOP Domain Coordinates for d1fz9a_:

Click to download the PDB-style file with coordinates for d1fz9a_.
(The format of our PDB-style files is described here.)

Timeline for d1fz9a_: