Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class zeta GST [81353] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [63555] (1 PDB entry) maleylacetoacetate isomerase |
Domain d1fw1a1: 1fw1 A:88-212 [60051] Other proteins in same PDB: d1fw1a2 complexed with dtt, gsh, so4 |
PDB Entry: 1fw1 (more details), 1.9 Å
SCOP Domain Sequences for d1fw1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} llpqdpkkrasvrmisdliaggiqplqnlsvlkqvgeemqltwaqnaitcgfnaleqilq stagiycvgdevtmadlclvpqvanaerfkvdltpyptissinkrllvleafqvshpcrq pdtpt
Timeline for d1fw1a1: