Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins) contains additional, fourth helix in the C-terminal extension |
Protein Germination protein GerE [63488] (1 species) single-domain protein homologous to the C-terminal domain of NarL |
Species Bacillus subtilis [TaxId:1423] [63489] (1 PDB entry) |
Domain d1fsea_: 1fse A: [60000] complexed with gol, so4 |
PDB Entry: 1fse (more details), 2.05 Å
SCOPe Domain Sequences for d1fsea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} skplltkrerevfellvqdkttkeiaselfisektvrnhisnamqklgvkgrsqavvell rmgelel
Timeline for d1fsea_: