SCOP 1.61: Domain d1fl2a1: 1fl2 A:212-325,A:452-521

Lineage for d1fl2a1 (1fl2 A:212-325,A:452-521)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)

6. Protein Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains [51953] (2 species)

7. Species Escherichia coli [TaxId:562] [63949] (1 PDB entry)

8. Domain d1fl2a1: 1fl2 A:212-325,A:452-521 [59869]

Details for d1fl2a1

PDB Entry: 1fl2, 1.9 Å

PDB Description: catalytic core component of the alkylhydroperoxide reductase ahpf from e.coli

SCOP Domain Sequences for d1fl2a1:

Sequence; same for both SEQRES and ATOM records:

>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli}
aydvlivgsgpagaaaaiysarkgirtglmgerfggqildtvdienyisvpktegqklag
alkvhvdeydvdvidsqsasklipaavegglhqietasgavlkarsiivatgakXlpntn
wlegavernrmgeiiidakcetnvkgvfaagdcttvpykqiiiatgegakaslsafdyli
rtkta

Timeline for d1fl2a1:

• d1fl2a1 first appeared in SCOP 1.57
  
• d1fl2a1 appears in SCOP 1.59
  
• d1fl2a1 appears in SCOP 1.63
  
• d1fl2a1 appears in the current release, SCOPe 2.08