Lineage for d1fgta2 (1fgt A:7-149)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 163751Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
  4. 163752Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (3 families) (S)
  5. 163753Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 163757Protein Plant lipoxigenase [49725] (2 species)
  7. 163758Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (8 PDB entries)
  8. 163763Domain d1fgta2: 1fgt A:7-149 [59831]
    Other proteins in same PDB: d1fgta1

Details for d1fgta2

PDB Entry: 1fgt (more details), 1.62 Å

PDB Description: lipoxygenase-1 (soybean) at 100k, q697n mutant

SCOP Domain Sequences for d1fgta2:

Sequence, based on SEQRES records: (download)

>d1fgta2 b.12.1.1 (A:7-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
kikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfleg
intslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirfv
cnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records): (download)

>d1fgta2 b.12.1.1 (A:7-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1}
kikgtvvlmpknellnaflgrsvslqlisatkadahgkgkvgkdtflegintslptlgag
esafnihfewdgsmgipgafyiknymqvefflksltletirfvcnswvyntklyksvrif
fanhty

SCOP Domain Coordinates for d1fgta2:

Click to download the PDB-style file with coordinates for d1fgta2.
(The format of our PDB-style files is described here.)

Timeline for d1fgta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgta1