Lineage for d1fe8i1 (1fe8 I:1-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740504Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 2740519Domain d1fe8i1: 1fe8 I:1-115 [59788]
    Other proteins in same PDB: d1fe8a_, d1fe8b_, d1fe8c_, d1fe8h2, d1fe8i2, d1fe8j2, d1fe8l1, d1fe8l2, d1fe8m1, d1fe8m2, d1fe8n1, d1fe8n2
    part of Fab RU5 inhibiting the collagen binding by the von willebrand factor a3 domain
    complexed with cac, nag

Details for d1fe8i1

PDB Entry: 1fe8 (more details), 2.03 Å

PDB Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
PDB Compounds: (I:) immunoglobulin igg ru5

SCOPe Domain Sequences for d1fe8i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fe8i1 b.1.1.1 (I:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
dvklvqsgpglvapsqslsitctvsgfslttygvswvrqppgkglewlgviwgdgnttyh
salisrlsiskdnsrsqvflklnslhtddtatyycagnyygmdywgqgtsvtvss

SCOPe Domain Coordinates for d1fe8i1:

Click to download the PDB-style file with coordinates for d1fe8i1.
(The format of our PDB-style files is described here.)

Timeline for d1fe8i1: