Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
Superfamily c.17.1: Caspase-like [52129] (3 families) mature protein may be composed of two chains folded in a single domain |
Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins) |
Protein Caspase-8 [52135] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52136] (8 PDB entries) |
Domain d1f9e.4: 1f9e G:,H: [59735] |
PDB Entry: 1f9e (more details), 2.9 Å
SCOPe Domain Sequences for d1f9e.4:
Sequence; same for both SEQRES and ATOM records: (download)
>g1f9e.4 c.17.1.1 (G:,H:) Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} ldkvyqmkskprgycliinnhnfakarekvpklhsirdrngthldagaltttfeelhfei kphhdctveqiyeilkiyqlmdhsnmdcficcilshgdkgiiygtdgqeapiyeltsqft glkcpslagkpkvffiqacqgdnyqkgipvetdXtryipdeadfllgmatvnncvsyrnp aegtwyiqslcqslrercprgddiltiltevnyevsnkddkknmgkqmpqptftlrkklv fps
Timeline for d1f9e.4: