![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (43 proteins) |
![]() | Protein Trypsin(ogen) [50515] (8 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries) |
![]() | Domain d1f5ra_: 1f5r A: [59654] Other proteins in same PDB: d1f5ri_ complexed with ca; mutant |
PDB Entry: 1f5r (more details), 1.65 Å
SCOP Domain Sequences for d1f5ra_:
Sequence, based on SEQRES records: (download)
>d1f5ra_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus)} dkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg wgntlssgvnepdllkcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
>d1f5ra_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus)} dkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg wgnepdllkcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngel qgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
Timeline for d1f5ra_: