Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.4: I set domains [49159] (25 proteins) |
Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-teminal domain [63665] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63666] (2 PDB entries) |
Domain d1f45a1: 1f45 A:1-87 [59639] Other proteins in same PDB: d1f45a2, d1f45a3, d1f45b_ |
PDB Entry: 1f45 (more details), 2.8 Å
SCOP Domain Sequences for d1f45a1:
Sequence, based on SEQRES records: (download)
>d1f45a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-teminal domain {Human (Homo sapiens)} iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef gdagqytchkggevlshsllllhkked
>d1f45a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-teminal domain {Human (Homo sapiens)} iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef gdagqytcshsllllhkked
Timeline for d1f45a1: