Lineage for d1f45a1 (1f45 A:1-87)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104938Protein The p40 domain of interleukin-12 (IL-12 beta chain), N-teminal domain [63665] (1 species)
  7. 104939Species Human (Homo sapiens) [TaxId:9606] [63666] (2 PDB entries)
  8. 104941Domain d1f45a1: 1f45 A:1-87 [59639]
    Other proteins in same PDB: d1f45a2, d1f45a3, d1f45b_

Details for d1f45a1

PDB Entry: 1f45 (more details), 2.8 Å

PDB Description: human interleukin-12

SCOP Domain Sequences for d1f45a1:

Sequence, based on SEQRES records: (download)

>d1f45a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-teminal domain {Human (Homo sapiens)}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytchkggevlshsllllhkked

Sequence, based on observed residues (ATOM records): (download)

>d1f45a1 b.1.1.4 (A:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-teminal domain {Human (Homo sapiens)}
iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
gdagqytcshsllllhkked

SCOP Domain Coordinates for d1f45a1:

Click to download the PDB-style file with coordinates for d1f45a1.
(The format of our PDB-style files is described here.)

Timeline for d1f45a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f45b_