Lineage for d1f42a3 (1f42 A:212-306)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105405Protein The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 [63672] (1 species)
  7. 105406Species Human (Homo sapiens) [TaxId:9606] [63673] (2 PDB entries)
  8. 105408Domain d1f42a3: 1f42 A:212-306 [59638]
    Other proteins in same PDB: d1f42a1

Details for d1f42a3

PDB Entry: 1f42 (more details), 2.5 Å

PDB Description: the p40 domain of human interleukin-12

SCOP Domain Sequences for d1f42a3:

Sequence, based on SEQRES records: (download)

>d1f42a3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens)}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrekkdrvftdk
tsatvicrknasisvraqdryyssswsewasvpcs

Sequence, based on observed residues (ATOM records): (download)

>d1f42a3 b.1.2.1 (A:212-306) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens)}
kpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvqvqgkskrrvftdktsat
vicrknasisvraqdryyssswsewasvpcs

SCOP Domain Coordinates for d1f42a3:

Click to download the PDB-style file with coordinates for d1f42a3.
(The format of our PDB-style files is described here.)

Timeline for d1f42a3: