Lineage for d1f23b_ (1f23 B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2646635Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 2646636Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 2646682Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 2646683Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 2646722Domain d1f23b_: 1f23 B: [59603]

Details for d1f23b_

PDB Entry: 1f23 (more details), 2.3 Å

PDB Description: contribution of a buried hydrogen bond to hiv-1 envelope glycoprotein structure and function
PDB Compounds: (B:) transmembrane glycoprotein

SCOPe Domain Sequences for d1f23b_:

Sequence, based on SEQRES records: (download)

>d1f23b_ h.3.2.1 (B:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgtkqlqarilsggrggwmewdreinnytslihsl
ieesqnqqekneqell

Sequence, based on observed residues (ATOM records): (download)

>d1f23b_ h.3.2.1 (B:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqnnllraieaqqhllqltvwgtkqlqarirggwmewdreinnytslihsliees
qnqqekneqell

SCOPe Domain Coordinates for d1f23b_:

Click to download the PDB-style file with coordinates for d1f23b_.
(The format of our PDB-style files is described here.)

Timeline for d1f23b_: