Lineage for d1f1hf2 (1f1h F:101-468)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610559Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 610560Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (4 families) (S)
  5. 610561Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (1 protein)
  6. 610562Protein Glutamine synthetase, C-terminal domain [55933] (2 species)
  7. 610612Species Salmonella typhimurium [TaxId:90371] [55934] (6 PDB entries)
  8. 610618Domain d1f1hf2: 1f1h F:101-468 [59583]
    Other proteins in same PDB: d1f1ha1, d1f1hb1, d1f1hc1, d1f1hd1, d1f1he1, d1f1hf1, d1f1hg1, d1f1hh1, d1f1hi1, d1f1hj1, d1f1hk1, d1f1hl1

Details for d1f1hf2

PDB Entry: 1f1h (more details), 2.67 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions

SCOP Domain Sequences for d1f1hf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f1hf2 d.128.1.1 (F:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium}
drdprsiakraedylratgiadtvlfgpepefflfddirfgasisgshvaiddiegawns
stkyeggnkghrpgvkggyfpvppvdsaqdirsemclvmeqmglvveahhhevatagqne
vatrfntmtkkadeiqiykyvvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtn
lfsgdkyaglseqalyyiggvikhakainalanpttnsykrlvpgyeapvmlaysarnrs
asiripvvaspkarrievrfpdpaanpylcfaallmagldgiknkihpgepmdknlydlp
peeakeipqvagsleealnaldldreflkaggvftdeaidayialrreeddrvrmtphpv
efelyysv

SCOP Domain Coordinates for d1f1hf2:

Click to download the PDB-style file with coordinates for d1f1hf2.
(The format of our PDB-style files is described here.)

Timeline for d1f1hf2: