Lineage for d1e8db_ (1e8d B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73984Family c.69.1.20: Hydroxynitrile lyase [53585] (1 protein)
  6. 73985Protein Hydroxynitrile lyase [53586] (2 species)
  7. 73986Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (5 PDB entries)
  8. 73990Domain d1e8db_: 1e8d B: [59384]

Details for d1e8db_

PDB Entry: 1e8d (more details), 2.2 Å

PDB Description: mechanistic aspects of cyanogenesis from active site mutant ser80ala of hydroxynitrile lyase from manihot esculenta in complex with acetone cyanohydrin

SCOP Domain Sequences for d1e8db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8db_ c.69.1.20 (B:) Hydroxynitrile lyase {Cassava (Manihot esculenta)}
mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
lltfleklpqgekviivgeacaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
tkteevahilqevadaya

SCOP Domain Coordinates for d1e8db_:

Click to download the PDB-style file with coordinates for d1e8db_.
(The format of our PDB-style files is described here.)

Timeline for d1e8db_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e8da_