SCOP 1.75: Domain d1dyqa1: 1dyq A:6-120

Lineage for d1dyqa1 (1dyq A:6-120)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [50220] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50221] (6 PDB entries)

8. Domain d1dyqa1: 1dyq A:6-120 [59140]
   Other proteins in same PDB: d1dyqa2
   mutant vaccine

Details for d1dyqa1

PDB Entry: 1dyq, 1.5 Å

PDB Description: staphylococcal enterotoxin a mutant vaccine

PDB Compounds: (A:) staphylococcal enterotoxin a mutant

SCOP Domain Sequences for d1dyqa1:

Sequence; same for both SEQRES and ATOM records:

>d1dyqa1 b.40.2.2 (A:6-120) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
einekdlrkkselqgtalgnlkqiyyynekaktenkeshdqfrqhtilfkgfftdhswyn
dllvrfdskdivdkykgkkvdlygayagyqcaggtpnktacmyggvtlhdnnrlt

Timeline for d1dyqa1:

• d1dyqa1 first appeared in SCOP 1.57
  
• d1dyqa1 appears in SCOP 1.73
  
• d1dyqa1 appears in SCOPe 2.01
  
• d1dyqa1 appears in the current release, SCOPe 2.08