SCOP 1.75: Domain d1dyqa2: 1dyq A:121-233

Lineage for d1dyqa2 (1dyq A:121-233)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)

8. Domain d1dyqa2: 1dyq A:121-233 [59141]
   Other proteins in same PDB: d1dyqa1
   mutant vaccine

Details for d1dyqa2

PDB Entry: 1dyq, 1.5 Å

PDB Description: staphylococcal enterotoxin a mutant vaccine

PDB Compounds: (A:) staphylococcal enterotoxin a mutant

SCOP Domain Sequences for d1dyqa2:

Sequence; same for both SEQRES and ATOM records:

>d1dyqa2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

Timeline for d1dyqa2:

• d1dyqa2 first appeared in SCOP 1.57
  
• d1dyqa2 appears in SCOP 1.73
  
• d1dyqa2 appears in SCOPe 2.01
  
• d1dyqa2 appears in the current release, SCOPe 2.08