Lineage for d2bcca2 (2bcc A:233-445)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)
  8. Domain d2bcca2: 2bcc A:233-445 [59050]
    Other proteins in same PDB: d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bcca2

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (A:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d2bcca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcca2 d.185.1.1 (A:233-445) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus) [TaxId: 9031]}
kcrftgsqirhredglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsss
plasiavtnklcqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsises
evlrgknflrnalvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcs
kyiydqcpavagpgpieqlpdynrirsgmfwlr

SCOPe Domain Coordinates for d2bcca2 are not available.

Timeline for d2bcca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bcca1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd2, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_