Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) |
Family d.92.1.2: Thermolysin-like [55490] (4 proteins) includes alpha-helical C-terminal domain characteristic for the family |
Protein Thermolysin [63414] (1 species) |
Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (51 PDB entries) |
Domain d1lnde_: 1lnd E: [59009] complexed with ca, dms, zn |
PDB Entry: 1lnd (more details), 1.7 Å
SCOP Domain Sequences for d1lnde_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnde_ d.92.1.2 (E:) Thermolysin {Bacillus thermoproteolyticus} itgtstvgvgrgvlgdqkninttystyyylqdntrgdgiftydakyrttlpgslwadadn qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsem vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts qevasvkqafdavgvk
Timeline for d1lnde_: