Lineage for d1bcca1 (1bcc A:4-232)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005158Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 3005159Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 3005181Species Chicken (Gallus gallus) [TaxId:9031] [55998] (3 PDB entries)
  8. 3005182Domain d1bcca1: 1bcc A:4-232 [58946]
    Other proteins in same PDB: d1bccb1, d1bccb2, d1bccc2, d1bccc3, d1bccd2, d1bccd3, d1bcce1, d1bcce2, d1bccf_, d1bccg_, d1bcch_, d1bccj_
    complexed with bog, fes, hem, pee, u10

Details for d1bcca1

PDB Entry: 1bcc (more details), 3.16 Å

PDB Description: cytochrome bc1 complex from chicken
PDB Compounds: (A:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1bcca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcca1 d.185.1.1 (A:4-232) Cytochrome bc1 core subunit 1 {Chicken (Gallus gallus) [TaxId: 9031]}
yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptls

SCOPe Domain Coordinates for d1bcca1:

Click to download the PDB-style file with coordinates for d1bcca1.
(The format of our PDB-style files is described here.)

Timeline for d1bcca1: