Lineage for d1zdb__ (1zdb -)

  1. Root: SCOP 1.65
  2. 348801Class k: Designed proteins [58788] (39 folds)
  3. 348997Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 348998Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 348999Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 349000Protein Protein A Ig(Fc)-binding domain mimics [58866] (1 species)
  7. 349001Species Synthetic [58867] (7 PDB entries)
  8. 349009Domain d1zdb__: 1zdb - [46436]
    phage-selected minidomain

Details for d1zdb__

PDB Entry: 1zdb (more details)

PDB Description: phage-selected mini protein a domain, z38, nmr, minimized mean structure

SCOP Domain Sequences for d1zdb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdb__ k.13.1.1 (-) Protein A Ig(Fc)-binding domain mimics {Synthetic}
avaqsfnmqqqrrfyealhdpnlneeqrnakiksirdd

SCOP Domain Coordinates for d1zdb__:

Click to download the PDB-style file with coordinates for d1zdb__.
(The format of our PDB-style files is described here.)

Timeline for d1zdb__: