Lineage for d1dxza_ (1dxz A:)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2651066Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 2651067Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 2651068Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 2651160Protein Membrane spanning segment 2 (M2) of the acetylcholine receptor [58540] (2 species)
  7. 2651164Species Pacific electric ray (Torpedo californica) [TaxId:7787] [58542] (2 PDB entries)
  8. 2651165Domain d1dxza_: 1dxz A: [46269]

Details for d1dxza_

PDB Entry: 1dxz (more details)

PDB Description: m2 transmembrane segment of alpha-subunit of nicotinic acetylcholine receptor from torpedo californica, nmr, 20 structures
PDB Compounds: (A:) acetylcholine receptor protein, alpha chain

SCOPe Domain Sequences for d1dxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxza_ j.35.1.1 (A:) Membrane spanning segment 2 (M2) of the acetylcholine receptor {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
ptdsgekmtlsisvllsltvfllvivelipst

SCOPe Domain Coordinates for d1dxza_:

Click to download the PDB-style file with coordinates for d1dxza_.
(The format of our PDB-style files is described here.)

Timeline for d1dxza_: