Class j: Peptides [58231] (148 folds) |
Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) |
Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
Protein Membrane spanning segment 2 (M2) of the acetylcholine receptor [58540] (2 species) |
Species Pacific electric ray (Torpedo californica) [TaxId:7787] [58542] (2 PDB entries) |
Domain d1dxza_: 1dxz A: [46269] |
PDB Entry: 1dxz (more details)
SCOPe Domain Sequences for d1dxza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxza_ j.35.1.1 (A:) Membrane spanning segment 2 (M2) of the acetylcholine receptor {Pacific electric ray (Torpedo californica) [TaxId: 7787]} ptdsgekmtlsisvllsltvfllvivelipst
Timeline for d1dxza_: