Lineage for d1mg1a2 (1mg1 A:371-455)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. Family h.3.2.1: Virus ectodomain [58070] (5 proteins)
  6. 42379Protein HTLV-1 gp21 [58074] (1 species)
  7. 42380Species Human T-cell leukemia virus type 1 [TaxId:11908] [58075] (1 PDB entry)
  8. 42381Domain d1mg1a2: 1mg1 A:371-455 [45753]
    Other proteins in same PDB: d1mg1a1

Details for d1mg1a2

PDB Entry: 1mg1 (more details), 2.5 Å

PDB Description: htlv-1 gp21 ectodomain/maltose-binding protein chimera

SCOP Domain Sequences for d1mg1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mg1a2 h.3.2.1 (A:371-455) HTLV-1 gp21 {Human T-cell leukemia virus type 1}
amslasgksllhevdkdisqltqaivknhknllkiaqyaaqnrrgldllfweqgglckal
qeqccflnitnshvsilqerpplen

SCOP Domain Coordinates for d1mg1a2:

Click to download the PDB-style file with coordinates for d1mg1a2.
(The format of our PDB-style files is described here.)

Timeline for d1mg1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mg1a1