Lineage for d2ezoc_ (2ezo C:)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145868Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. 145929Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 145930Family h.3.2.1: Virus ectodomain [58070] (6 proteins)
  6. 145965Protein Retrovius gp41 protease-resistant core [58071] (3 species)
  7. 145985Species Simian immunodeficiency virus [58073] (8 PDB entries)
  8. 146006Domain d2ezoc_: 2ezo C: [45749]

Details for d2ezoc_

PDB Entry: 2ezo (more details)

PDB Description: solution nmr structure of ectodomain of siv gp41, restrained regularized mean structure

SCOP Domain Sequences for d2ezoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezoc_ h.3.2.1 (C:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOP Domain Coordinates for d2ezoc_:

Click to download the PDB-style file with coordinates for d2ezoc_.
(The format of our PDB-style files is described here.)

Timeline for d2ezoc_: