Lineage for d1fzff2 (1fzf F:109-141)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644538Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2644539Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2644651Protein Fibrinogen gamma chain [88898] (4 species)
  7. 2644660Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
    Uniprot P02679
  8. 2644671Domain d1fzff2: 1fzf F:109-141 [45601]
    Other proteins in same PDB: d1fzfa_, d1fzfb1, d1fzfb2, d1fzfc1, d1fzfd_, d1fzfe1, d1fzfe2, d1fzff1
    coiled-coil region only
    complexed with ca, nag

Details for d1fzff2

PDB Entry: 1fzf (more details), 2.7 Å

PDB Description: crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide
PDB Compounds: (F:) fibrinogen

SCOPe Domain Sequences for d1fzff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzff2 h.1.8.1 (F:109-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
ylqeiynsnnqkivnlkekvaqleaqcqepckd

SCOPe Domain Coordinates for d1fzff2:

Click to download the PDB-style file with coordinates for d1fzff2.
(The format of our PDB-style files is described here.)

Timeline for d1fzff2: