Lineage for d1rafb2 (1raf B:101-153)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751015Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 751016Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 751017Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)
  7. 751021Species Escherichia coli [TaxId:562] [57828] (41 PDB entries)
  8. 751068Domain d1rafb2: 1raf B:101-153 [45283]
    Other proteins in same PDB: d1rafa1, d1rafa2, d1rafb1, d1rafc1, d1rafc2, d1rafd1

Details for d1rafb2

PDB Entry: 1raf (more details), 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1rafb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rafb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1rafb2:

Click to download the PDB-style file with coordinates for d1rafb2.
(The format of our PDB-style files is described here.)

Timeline for d1rafb2: