SCOP 1.73: Domain d1raid2: 1rai D:101-153

Lineage for d1raid2 (1rai D:101-153)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)

7. Species Escherichia coli [TaxId:562] [57828] (41 PDB entries)

8. Domain d1raid2: 1rai D:101-153 [45282]
   Other proteins in same PDB: d1raia1, d1raia2, d1raib1, d1raic1, d1raic2, d1raid1
   complexed with ctp, zn

Details for d1raid2

PDB Entry: 1rai, 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1raid2:

Sequence; same for both SEQRES and ATOM records:

>d1raid2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1raid2:

• d1raid2 first appeared (with stable ids) in SCOP 1.55
  
• d1raid2 appears in SCOP 1.71
  
• d1raid2 appears in SCOP 1.75
  
• d1raid2 appears in the current release, SCOPe 2.08