SCOP 1.61: Domain d1dfx_2: 1dfx 1-36

Lineage for d1dfx_2 (1dfx 1-36)

1. Root: SCOP 1.61

2. Class g: Small proteins [56992] (59 folds)

3. Fold g.41: Rubredoxin-like [57769] (9 superfamilies)

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.2: Desulforedoxin [57813] (2 proteins)

6. Protein Desulfoferrodoxin N-terminal domain [57816] (1 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [57817] (1 PDB entry)

8. Domain d1dfx_2: 1dfx 1-36 [45255]
   Other proteins in same PDB: d1dfx_1

Details for d1dfx_2

PDB Entry: 1dfx, 1.9 Å

PDB Description: desulfoferrodoxin from desulfovibrio desulfuricans, atcc 27774

SCOP Domain Sequences for d1dfx_2:

Sequence; same for both SEQRES and ATOM records:

>d1dfx_2 g.41.5.2 (1-36) Desulfoferrodoxin N-terminal domain {Desulfovibrio desulfuricans}
pkhlevykcthcgnivevlhgggaelvccgepmkhm

Timeline for d1dfx_2:

• d1dfx_2 first appeared (with stable ids) in SCOP 1.55
  
• d1dfx_2 appears in SCOP 1.59
  
• d1dfx_2 appears in SCOP 1.63
  
• d1dfx_2 appears in the current release, SCOPe 2.08, called d1dfxa2