![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) ![]() |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries) contains a rudiment "zinc-finger" subdomain |
![]() | Domain d1dvrb2: 1dvr B:131-168 [45201] Other proteins in same PDB: d1dvra1, d1dvrb1 complexed with atf; mutant |
PDB Entry: 1dvr (more details), 2.36 Å
SCOP Domain Sequences for d1dvrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvrb2 g.41.2.1 (B:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae)} grlihpasgrsyhkifnppkedmkddvtgealvqisdd
Timeline for d1dvrb2: