Lineage for d1dvra2 (1dvr A:131-168)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624629Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 624630Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 624631Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 624640Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries)
    contains a rudiment "zinc-finger" subdomain
  8. 624644Domain d1dvra2: 1dvr A:131-168 [45200]
    Other proteins in same PDB: d1dvra1, d1dvrb1

Details for d1dvra2

PDB Entry: 1dvr (more details), 2.36 Å

PDB Description: structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp

SCOP Domain Sequences for d1dvra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvra2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae)}
grlihpasgrsyhkifnppkedmkddvtgealvqisdd

SCOP Domain Coordinates for d1dvra2:

Click to download the PDB-style file with coordinates for d1dvra2.
(The format of our PDB-style files is described here.)

Timeline for d1dvra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dvra1