![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (14 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) ![]() |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
![]() | Species Escherichia coli [TaxId:562] [57778] (6 PDB entries) contains a rudiment form of the domain that lacks zn-binding site |
![]() | Domain d4akeb2: 4ake B:122-156 [45190] Other proteins in same PDB: d4akea1, d4akeb1 |
PDB Entry: 4ake (more details), 2.2 Å
SCOP Domain Sequences for d4akeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4akeb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli} grrvhapsgrvyhvkfnppkvegkddvtgeelttr
Timeline for d4akeb2: