Lineage for d4akea2 (4ake A:122-156)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624629Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 624630Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 624631Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 624652Species Escherichia coli [TaxId:562] [57778] (6 PDB entries)
    contains a rudiment form of the domain that lacks zn-binding site
  8. 624661Domain d4akea2: 4ake A:122-156 [45189]
    Other proteins in same PDB: d4akea1, d4akeb1

Details for d4akea2

PDB Entry: 4ake (more details), 2.2 Å

PDB Description: adenylate kinase

SCOP Domain Sequences for d4akea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4akea2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOP Domain Coordinates for d4akea2:

Click to download the PDB-style file with coordinates for d4akea2.
(The format of our PDB-style files is described here.)

Timeline for d4akea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4akea1