Class g: Small proteins [56992] (56 folds) |
Fold g.41: Rubredoxin-like [57769] (9 superfamilies) |
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) |
Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species) |
Species Bacillus stearothermophilus [TaxId:1422] [57777] (3 PDB entries) |
Domain d1zin_2: 1zin 126-160 [45178] Other proteins in same PDB: d1zin_1 |
PDB Entry: 1zin (more details), 1.6 Å
SCOP Domain Sequences for d1zin_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zin_2 g.41.2.1 (126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus} grricrncgatyhlifhppakpgvcdkcggelyqr
Timeline for d1zin_2: