Lineage for d1d0gs2 (1d0g S:62-101)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523386Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 523387Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 523388Family g.24.1.1: TNF receptor-like [57587] (4 proteins)
    TNFR/NGFR cysteine-rich region (Pfam 00020)
  6. 523393Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 523394Species Human (Homo sapiens) [TaxId:9606] [57591] (3 PDB entries)
  8. 523402Domain d1d0gs2: 1d0g S:62-101 [44922]
    Other proteins in same PDB: d1d0ga_, d1d0gb_, d1d0gd_

Details for d1d0gs2

PDB Entry: 1d0g (more details), 2.4 Å

PDB Description: crystal structure of death receptor 5 (dr5) bound to apo2l/trail

SCOP Domain Sequences for d1d0gs2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0gs2 g.24.1.1 (S:62-101) Death receptor-5 (dr5) fragment {Human (Homo sapiens)}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOP Domain Coordinates for d1d0gs2:

Click to download the PDB-style file with coordinates for d1d0gs2.
(The format of our PDB-style files is described here.)

Timeline for d1d0gs2: