| Class g: Small proteins [56992] (100 folds) |
| Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
| Family g.24.1.1: TNF receptor-like [57587] (13 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
| Protein Death receptor-5 (dr5) fragment, N- and C-terminal domain [419060] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [419551] (5 PDB entries) |
| Domain d1d0gs1: 1d0g S:21-61 [44921] Other proteins in same PDB: d1d0ga_, d1d0gb_, d1d0gd_, d1d0gr2, d1d0gs2, d1d0gt2 complexed with cl, zn fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1d0g (more details), 2.4 Å
SCOPe Domain Sequences for d1d0gs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0gs1 g.24.1.1 (S:21-61) Death receptor-5 (dr5) fragment, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sspseglcppghhisedgrdcisckygqdysthwndllfcl
Timeline for d1d0gs1: