Lineage for d1d0gs1 (1d0g S:21-61)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 3034679Protein Death receptor-5 (dr5) fragment, N- and C-terminal domain [419060] (1 species)
  7. 3034680Species Human (Homo sapiens) [TaxId:9606] [419551] (5 PDB entries)
  8. 3034700Domain d1d0gs1: 1d0g S:21-61 [44921]
    Other proteins in same PDB: d1d0ga_, d1d0gb_, d1d0gd_, d1d0gr2, d1d0gs2, d1d0gt2
    complexed with cl, zn
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1d0gs1

PDB Entry: 1d0g (more details), 2.4 Å

PDB Description: crystal structure of death receptor 5 (dr5) bound to apo2l/trail
PDB Compounds: (S:) death receptor-5

SCOPe Domain Sequences for d1d0gs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0gs1 g.24.1.1 (S:21-61) Death receptor-5 (dr5) fragment, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sspseglcppghhisedgrdcisckygqdysthwndllfcl

SCOPe Domain Coordinates for d1d0gs1:

Click to download the PDB-style file with coordinates for d1d0gs1.
(The format of our PDB-style files is described here.)

Timeline for d1d0gs1: