Lineage for d1btgc_ (1btg C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638544Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2638545Protein beta-Nerve growth factor [57525] (2 species)
  7. 2638558Species Mouse (Mus musculus) [TaxId:10090] [57526] (4 PDB entries)
  8. 2638562Domain d1btgc_: 1btg C: [44804]
    complexed with zn

Details for d1btgc_

PDB Entry: 1btg (more details), 2.5 Å

PDB Description: crystal structure of beta nerve growth factor at 2.5 a resolution in c2 space group with zn ions bound
PDB Compounds: (C:) beta nerve growth factor

SCOPe Domain Sequences for d1btgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btgc_ g.17.1.3 (C:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr

SCOPe Domain Coordinates for d1btgc_:

Click to download the PDB-style file with coordinates for d1btgc_.
(The format of our PDB-style files is described here.)

Timeline for d1btgc_: