SCOP 1.65: Domain d1tfg__: 1tfg -

Lineage for d1tfg__ (1tfg -)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulphide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (7 proteins)

6. Protein TGF-beta2 [57510] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57511] (2 PDB entries)

8. Domain d1tfg__: 1tfg - [44778]

Details for d1tfg__

PDB Entry: 1tfg, 1.95 Å

PDB Description: an unusual feature revealed by the crystal structure at 2.2 angstroms resolution of human transforming growth factor-beta2

SCOP Domain Sequences for d1tfg__:

Sequence; same for both SEQRES and ATOM records:

>d1tfg__ g.17.1.2 (-) TGF-beta2 {Human (Homo sapiens)}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs

Timeline for d1tfg__:

• d1tfg__ first appeared (with stable ids) in SCOP 1.55
  
• d1tfg__ appears in SCOP 1.63
  
• d1tfg__ appears in SCOP 1.67
  
• d1tfg__ appears in the current release, SCOPe 2.08, called d1tfga_