Lineage for d1tbqs1 (1tbq S:1-51)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465700Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 1465701Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 1465702Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 1465706Protein Blood-sucking insect-derived tryptase inhibitor [57476] (2 species)
    duplication: contains two domains of this fold
  7. 1465707Species Rhodnius prolixus, rhodniin [TaxId:13249] [57477] (2 PDB entries)
  8. 1465714Domain d1tbqs1: 1tbq S:1-51 [44713]
    Other proteins in same PDB: d1tbq.1, d1tbq.2

Details for d1tbqs1

PDB Entry: 1tbq (more details), 3.1 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
PDB Compounds: (S:) rhodniin

SCOPe Domain Sequences for d1tbqs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbqs1 g.68.1.1 (S:1-51) Blood-sucking insect-derived tryptase inhibitor {Rhodnius prolixus, rhodniin [TaxId: 13249]}
eggepcacphalhrvcgsdgetysnpctlncakfngkpelvkvhdgpcepd

SCOPe Domain Coordinates for d1tbqs1:

Click to download the PDB-style file with coordinates for d1tbqs1.
(The format of our PDB-style files is described here.)

Timeline for d1tbqs1: