Lineage for d1pdc__ (1pdc -)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203830Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 203831Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 203907Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
  6. 203947Protein PDC-109, collagen-binding type II domain [57460] (1 species)
  7. 203948Species Cow (Bos taurus) [TaxId:9913] [57461] (2 PDB entries)
  8. 203953Domain d1pdc__: 1pdc - [44667]

Details for d1pdc__

PDB Entry: 1pdc (more details)

PDB Description: refined solution structure and ligand-binding properties of pdc-109 domain b. a collagen-binding type ii domain

SCOP Domain Sequences for d1pdc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdc__ g.14.1.2 (-) PDC-109, collagen-binding type II domain {Cow (Bos taurus)}
dyakcvfpfiyggkkyetctkigsmwmswcslspnydkdrawkyc

SCOP Domain Coordinates for d1pdc__:

Click to download the PDB-style file with coordinates for d1pdc__.
(The format of our PDB-style files is described here.)

Timeline for d1pdc__: