Lineage for d2pf1a1 (2pf1 A:66-156)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890943Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 890944Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 890945Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 891019Protein Prothrombin [57448] (1 species)
  7. 891020Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries)
  8. 891025Domain d2pf1a1: 2pf1 A:66-156 [44652]
    Other proteins in same PDB: d2pf1a2

Details for d2pf1a1

PDB Entry: 2pf1 (more details), 2.8 Å

PDB Description: structure of bovine prothrombin fragment 1 refined at 2.25 angstroms resolution
PDB Compounds: (A:) prothrombin fragment 1

SCOP Domain Sequences for d2pf1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pf1a1 g.14.1.1 (A:66-156) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgqdrvtvevipr

SCOP Domain Coordinates for d2pf1a1:

Click to download the PDB-style file with coordinates for d2pf1a1.
(The format of our PDB-style files is described here.)

Timeline for d2pf1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pf1a2