SCOP 1.63: Domain d1ceaa_: 1cea A:

Lineage for d1ceaa_ (1cea A:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulphide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (2 families)

5. Family g.14.1.1: Kringle modules [57441] (6 proteins)

6. Protein Plasminogen [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)

8. Domain d1ceaa_: 1cea A: [44644]

Details for d1ceaa_

PDB Entry: 1cea, 2.1 Å

PDB Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with eaca (epsilon-aminocaproic acid)

SCOP Domain Sequences for d1ceaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ceaa_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens)}
ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
pwcyttdpekrydycdilec

Timeline for d1ceaa_:

• d1ceaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ceaa_ appears in SCOP 1.61
  
• d1ceaa_ appears in SCOP 1.65
  
• d1ceaa_ appears in the current release, SCOPe 2.08