SCOPe 2.04: Domain d1tpkb_: 1tpk B:

Lineage for d1tpkb_ (1tpk B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Plasminogen [63400] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)

8. Domain d1tpkb_: 1tpk B: [44638]
   kringle 2
   complexed with cl

Details for d1tpkb_

PDB Entry: 1tpk, 2.4 Å

PDB Description: crystal structure of the kringle-2 domain of tissue plasminogen activator at 2.4-angstroms resolution

PDB Compounds: (B:) tissue plasminogen activator

SCOPe Domain Sequences for d1tpkb_:

Sequence; same for both SEQRES and ATOM records:

>d1tpkb_ g.14.1.1 (B:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
dgdakpwchvlknrrltweycdvpscst

Timeline for d1tpkb_:

• d1tpkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tpkb_ appears in SCOPe 2.03
  
• d1tpkb_ appears in SCOPe 2.05
  
• d1tpkb_ appears in the current release, SCOPe 2.08