Lineage for d1tpka_ (1tpk A:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily) Superfamily g.14.1: Kringle-like [57440] (2 families) 
Family g.14.1.1: Kringle modules [57441] (8 proteins) 
Protein Plasminogen kringle 2 [57444] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57445] (3 PDB entries) 
Domain d1tpka_: 1tpk A: [44637]
Details for d1tpka_
PDB Entry: 1tpk (more details), 2.4 Å
PDB Description: crystal structure of the kringle-2 domain of tissue plasminogen activator at 2.4-angstroms resolution
SCOP Domain Sequences for d1tpka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tpka_ g.14.1.1 (A:) Plasminogen kringle 2 {Human (Homo sapiens)}
gnsdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnp
dgdakpwchvlknrrltweycdvpscst
SCOP Domain Coordinates for d1tpka_:
Click to download the PDB-style file with coordinates for d1tpka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tpka_:
- d1tpka_ appears in SCOP 1.57
- d1tpka_ appears in the current release, SCOPe 2.08
View in 3D
