Lineage for d1pmka_ (1pmk A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 428891Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 428892Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 428893Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 428930Protein Plasminogen [63400] (1 species)
  7. 428931Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)
  8. 428951Domain d1pmka_: 1pmk A: [44635]

Details for d1pmka_

PDB Entry: 1pmk (more details), 2.25 Å

PDB Description: kringle-kringle interactions in multimer kringle structures

SCOP Domain Sequences for d1pmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmka_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens)}
cyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgpw
cfttdpsvrweycnlkkc

SCOP Domain Coordinates for d1pmka_:

Click to download the PDB-style file with coordinates for d1pmka_.
(The format of our PDB-style files is described here.)

Timeline for d1pmka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pmkb_