Class g: Small proteins [56992] (91 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein Plasminogen [63400] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries) |
Domain d1pmlb_: 1pml B: [44633] kringle 4 complexed with cl |
PDB Entry: 1pml (more details), 2.38 Å
SCOPe Domain Sequences for d1pmlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmlb_ g.14.1.1 (B:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]} sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg dakpwchvlknrrltweycdvpscst
Timeline for d1pmlb_: