SCOPe 2.07: Domain d1ldla_: 1ldl A:

Lineage for d1ldla_ (1ldl A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families)

5. Family g.12.1.1: LDL receptor-like module [57425] (7 proteins)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries)
   Uniprot P01130 272-353

8. Domain d1ldla_: 1ldl A: [44615]
   first module

Details for d1ldla_

PDB Entry: 1ldl

PDB Description: three-dimensional structure of a cysteine-rich repeat from the low- density lipoprotein receptor

PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1ldla_:

Sequence; same for both SEQRES and ATOM records:

>d1ldla_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
avgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvt

Timeline for d1ldla_:

• d1ldla_ first appeared (with stable ids) in SCOP 1.55, called d1ldl__
  
• d1ldla_ appears in SCOPe 2.06
  
• d1ldla_ appears in the current release, SCOPe 2.08